PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.H00158.1.p
Common NameEUGRSUZ_H00158
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 267aa    MW: 29799.1 Da    PI: 4.8002
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.H00158.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72.1e-16552148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT++Ed+ l+ ++++ G g+W++ ++  g+ R++k+c++rw +yl
  Eucgr.H00158.1.p  5 RGPWTPDEDQVLISYIQRNGHGNWRALPKQAGLLRCGKSCRLRWINYL 52
                      89******************************99************97 PP

2Myb_DNA-binding51.13.1e-1658103148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++  eE+e +++++++lG++ W++Ia++++ gRt++++k+ w+++l
  Eucgr.H00158.1.p  58 RGNFNSEEEETIIKLHEMLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 103
                       89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.79E-30199IPR009057Homeodomain-like
PROSITE profilePS5129418.114152IPR017930Myb domain
SMARTSM007173.3E-12454IPR001005SANT/Myb domain
PfamPF002493.5E-15552IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-24659IPR009057Homeodomain-like
CDDcd001674.86E-10752No hitNo description
PROSITE profilePS5129424.69953107IPR017930Myb domain
SMARTSM007173.6E-1457105IPR001005SANT/Myb domain
PfamPF002499.6E-1558103IPR001005SANT/Myb domain
CDDcd001679.60E-1160103No hitNo description
Gene3DG3DSA:1.10.10.605.1E-2660108IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MGLKRGPWTP DEDQVLISYI QRNGHGNWRA LPKQAGLLRC GKSCRLRWIN YLRPDIKRGN  60
FNSEEEETII KLHEMLGNRW SAIAARLPGR TDNEIKNVWH THLKKRLKQN QVTPATTTTN  120
NKSFNLDSSE PTIPRLLESS VHAPMSPQPS SSEISSVTDA STSTGIGEAN NIEIKGEDME  180
YSMESFPLID ESFWSDNPGF LPDEYSSDSS GLSCFNVDTQ TQYSVAPMAD NVQGWPSDGV  240
SHVDNGMDFW YDLFIRAGGA EELPAF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-2631075108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1102108LKKRLKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00375DAPTransfer from AT3G23250Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.H00158.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010069126.10.0PREDICTED: myb-related protein Myb4
TrEMBLA0A059ATU10.0A0A059ATU1_EUCGR; Uncharacterized protein
STRINGPOPTR_0008s16660.13e-92(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.18e-76myb domain protein 15